Anti C1QTNF3 pAb (ATL-HPA066011)

Atlas Antibodies

Catalog No.: ATL-HPA066011-25

Protein Description: C1q and tumor necrosis factor related protein 3
Gene Name: C1QTNF3
Alternative Gene Name: 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058914: 94%, ENSRNOG00000018570: 73%
Entrez Gene ID: 114899
Uniprot ID: Q9BXJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG
• Gene Sequence: CQDEYMESPQTGGLPPDCSKCCHGDYSFRGYQG
• Gene ID - Mouse: ENSMUSG00000058914
• Gene ID - Rat: ENSRNOG00000018570
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.