Anti C1QTNF3 pAb (ATL-HPA064996)

Atlas Antibodies

SKU:
ATL-HPA064996-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: C1q and tumor necrosis factor related protein 3
Gene Name: C1QTNF3
Alternative Gene Name: 2310005P21Rik, Corcs, Cors, Cors-26, CTRP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058914: 98%, ENSRNOG00000018570: 98%
Entrez Gene ID: 114899
Uniprot ID: Q9BXJ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFET
Gene Sequence MYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFET
Gene ID - Mouse ENSMUSG00000058914
Gene ID - Rat ENSRNOG00000018570
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C1QTNF3 pAb (ATL-HPA064996)
Datasheet Anti C1QTNF3 pAb (ATL-HPA064996) Datasheet (External Link)
Vendor Page Anti C1QTNF3 pAb (ATL-HPA064996) at Atlas Antibodies

Documents & Links for Anti C1QTNF3 pAb (ATL-HPA064996)
Datasheet Anti C1QTNF3 pAb (ATL-HPA064996) Datasheet (External Link)
Vendor Page Anti C1QTNF3 pAb (ATL-HPA064996)