Anti C1QTNF12 pAb (ATL-HPA024107)

Atlas Antibodies

Catalog No.:
ATL-HPA024107-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: C1q and tumor necrosis factor related protein 12
Gene Name: C1QTNF12
Alternative Gene Name: ADIPOLIN, C1QDC2, CTRP12, FAM132A, MGC105127
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023571: 65%, ENSRNOG00000019864: 65%
Entrez Gene ID: 388581
Uniprot ID: Q5T7M4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLD
Gene Sequence DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLD
Gene ID - Mouse ENSMUSG00000023571
Gene ID - Rat ENSRNOG00000019864
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1QTNF12 pAb (ATL-HPA024107)
Datasheet Anti C1QTNF12 pAb (ATL-HPA024107) Datasheet (External Link)
Vendor Page Anti C1QTNF12 pAb (ATL-HPA024107) at Atlas Antibodies

Documents & Links for Anti C1QTNF12 pAb (ATL-HPA024107)
Datasheet Anti C1QTNF12 pAb (ATL-HPA024107) Datasheet (External Link)
Vendor Page Anti C1QTNF12 pAb (ATL-HPA024107)