Anti C1QTNF12 pAb (ATL-HPA024107)

Atlas Antibodies

Catalog No.: ATL-HPA024107-25

Protein Description: C1q and tumor necrosis factor related protein 12
Gene Name: C1QTNF12
Alternative Gene Name: ADIPOLIN, C1QDC2, CTRP12, FAM132A, MGC105127
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023571: 65%, ENSRNOG00000019864: 65%
Entrez Gene ID: 388581
Uniprot ID: Q5T7M4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLD
• Gene Sequence: DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLD
• Gene ID - Mouse: ENSMUSG00000023571
• Gene ID - Rat: ENSRNOG00000019864
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.