Anti C1QC pAb (ATL-HPA001471)

Atlas Antibodies

Catalog No.: ATL-HPA001471-25

Protein Description: complement component 1, q subcomponent, C chain
Gene Name: C1QC
Alternative Gene Name: C1QG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036896: 70%, ENSRNOG00000012804: 73%
Entrez Gene ID: 714
Uniprot ID: P02747
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSD
• Gene Sequence: GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSD
• Gene ID - Mouse: ENSMUSG00000036896
• Gene ID - Rat: ENSRNOG00000012804
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C1QC pAb (ATL-HPA001471) – 1 Found

Neiman, Maja; Fredolini, Claudia; Johansson, Henrik; Lehtiö, Janne; Nygren, Per-Åke; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Selectivity analysis of single binder assays used in plasma protein profiling. Proteomics. 2013;13(23-24):3406-10.