Anti C1QC pAb (ATL-HPA001471)

Atlas Antibodies

Catalog No.:
ATL-HPA001471-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: complement component 1, q subcomponent, C chain
Gene Name: C1QC
Alternative Gene Name: C1QG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036896: 70%, ENSRNOG00000012804: 73%
Entrez Gene ID: 714
Uniprot ID: P02747
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSD
Gene Sequence GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSD
Gene ID - Mouse ENSMUSG00000036896
Gene ID - Rat ENSRNOG00000012804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1QC pAb (ATL-HPA001471)
Datasheet Anti C1QC pAb (ATL-HPA001471) Datasheet (External Link)
Vendor Page Anti C1QC pAb (ATL-HPA001471) at Atlas Antibodies

Documents & Links for Anti C1QC pAb (ATL-HPA001471)
Datasheet Anti C1QC pAb (ATL-HPA001471) Datasheet (External Link)
Vendor Page Anti C1QC pAb (ATL-HPA001471)
Citations for Anti C1QC pAb (ATL-HPA001471) – 1 Found
Neiman, Maja; Fredolini, Claudia; Johansson, Henrik; Lehtiö, Janne; Nygren, Per-Åke; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Selectivity analysis of single binder assays used in plasma protein profiling. Proteomics. 2013;13(23-24):3406-10.  PubMed