Anti C1QC pAb (ATL-HPA001471)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001471-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C1QC
Alternative Gene Name: C1QG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036896: 70%, ENSRNOG00000012804: 73%
Entrez Gene ID: 714
Uniprot ID: P02747
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSD |
Gene Sequence | GIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSD |
Gene ID - Mouse | ENSMUSG00000036896 |
Gene ID - Rat | ENSRNOG00000012804 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C1QC pAb (ATL-HPA001471) | |
Datasheet | Anti C1QC pAb (ATL-HPA001471) Datasheet (External Link) |
Vendor Page | Anti C1QC pAb (ATL-HPA001471) at Atlas Antibodies |
Documents & Links for Anti C1QC pAb (ATL-HPA001471) | |
Datasheet | Anti C1QC pAb (ATL-HPA001471) Datasheet (External Link) |
Vendor Page | Anti C1QC pAb (ATL-HPA001471) |
Citations for Anti C1QC pAb (ATL-HPA001471) – 1 Found |
Neiman, Maja; Fredolini, Claudia; Johansson, Henrik; Lehtiö, Janne; Nygren, Per-Åke; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Selectivity analysis of single binder assays used in plasma protein profiling. Proteomics. 2013;13(23-24):3406-10. PubMed |