Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA026483-25

• 
• 
• 

Protein Description: complement component 1, q subcomponent binding protein
Gene Name: C1QBP
Alternative Gene Name: gC1Q-R, gC1qR, HABP1, p32, SF2p32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018446: 90%, ENSRNOG00000006949: 90%
Entrez Gene ID: 708
Uniprot ID: Q07021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY
• Gene Sequence: GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY
• Gene ID - Mouse: ENSMUSG00000018446
• Gene ID - Rat: ENSRNOG00000006949
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) – 3 Found

Raffo-Romero, Antonella; Arab, Tanina; Van Camp, Christelle; Lemaire, Quentin; Wisztorski, Maxence; Franck, Julien; Aboulouard, Soulaimane; Le Marrec-Croq, Francoise; Sautiere, Pierre-Eric; Vizioli, Jacopo; Salzet, Michel; Lefebvre, Christophe. ALK4/5-dependent TGF-β signaling contributes to the crosstalk between neurons and microglia following axonal lesion. Scientific Reports. 2019;9(1):6896. 

Matos, P; Horn, J A; Beards, F; Lui, S; Desforges, M; Harris, L K. A role for the mitochondrial-associated protein p32 in regulation of trophoblast proliferation. Molecular Human Reproduction. 2014;20(8):745-55. 

Wang, Xiaowan; Zhang, Zhe; Zhang, Nannan; Li, Hailong; Zhang, Li; Baines, Christopher P; Ding, Shinghua. Subcellular NAMPT-mediated NAD(+) salvage pathways and their roles in bioenergetics and neuronal protection after ischemic injury. Journal Of Neurochemistry. 2019;151(6):732-748.