Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026483-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C1QBP
Alternative Gene Name: gC1Q-R, gC1qR, HABP1, p32, SF2p32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018446: 90%, ENSRNOG00000006949: 90%
Entrez Gene ID: 708
Uniprot ID: Q07021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY |
| Gene Sequence | GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY |
| Gene ID - Mouse | ENSMUSG00000018446 |
| Gene ID - Rat | ENSRNOG00000006949 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) | |
| Datasheet | Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) | |
| Datasheet | Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) |
| Citations for Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) – 3 Found |
| Raffo-Romero, Antonella; Arab, Tanina; Van Camp, Christelle; Lemaire, Quentin; Wisztorski, Maxence; Franck, Julien; Aboulouard, Soulaimane; Le Marrec-Croq, Francoise; Sautiere, Pierre-Eric; Vizioli, Jacopo; Salzet, Michel; Lefebvre, Christophe. ALK4/5-dependent TGF-β signaling contributes to the crosstalk between neurons and microglia following axonal lesion. Scientific Reports. 2019;9(1):6896. PubMed |
| Matos, P; Horn, J A; Beards, F; Lui, S; Desforges, M; Harris, L K. A role for the mitochondrial-associated protein p32 in regulation of trophoblast proliferation. Molecular Human Reproduction. 2014;20(8):745-55. PubMed |
| Wang, Xiaowan; Zhang, Zhe; Zhang, Nannan; Li, Hailong; Zhang, Li; Baines, Christopher P; Ding, Shinghua. Subcellular NAMPT-mediated NAD(+) salvage pathways and their roles in bioenergetics and neuronal protection after ischemic injury. Journal Of Neurochemistry. 2019;151(6):732-748. PubMed |