Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA026483-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: complement component 1, q subcomponent binding protein
Gene Name: C1QBP
Alternative Gene Name: gC1Q-R, gC1qR, HABP1, p32, SF2p32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018446: 90%, ENSRNOG00000006949: 90%
Entrez Gene ID: 708
Uniprot ID: Q07021
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY
Gene Sequence GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY
Gene ID - Mouse ENSMUSG00000018446
Gene ID - Rat ENSRNOG00000006949
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation)
Datasheet Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation)
Datasheet Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation)
Citations for Anti C1QBP pAb (ATL-HPA026483 w/enhanced validation) – 3 Found
Raffo-Romero, Antonella; Arab, Tanina; Van Camp, Christelle; Lemaire, Quentin; Wisztorski, Maxence; Franck, Julien; Aboulouard, Soulaimane; Le Marrec-Croq, Francoise; Sautiere, Pierre-Eric; Vizioli, Jacopo; Salzet, Michel; Lefebvre, Christophe. ALK4/5-dependent TGF-β signaling contributes to the crosstalk between neurons and microglia following axonal lesion. Scientific Reports. 2019;9(1):6896.  PubMed
Matos, P; Horn, J A; Beards, F; Lui, S; Desforges, M; Harris, L K. A role for the mitochondrial-associated protein p32 in regulation of trophoblast proliferation. Molecular Human Reproduction. 2014;20(8):745-55.  PubMed
Wang, Xiaowan; Zhang, Zhe; Zhang, Nannan; Li, Hailong; Zhang, Li; Baines, Christopher P; Ding, Shinghua. Subcellular NAMPT-mediated NAD(+) salvage pathways and their roles in bioenergetics and neuronal protection after ischemic injury. Journal Of Neurochemistry. 2019;151(6):732-748.  PubMed