Anti C1QB pAb (ATL-HPA052116)

Atlas Antibodies

Catalog No.:
ATL-HPA052116-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: complement component 1, q subcomponent, B chain
Gene Name: C1QB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036905: 77%, ENSRNOG00000012749: 77%
Entrez Gene ID: 713
Uniprot ID: P02746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKV
Gene Sequence PKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKV
Gene ID - Mouse ENSMUSG00000036905
Gene ID - Rat ENSRNOG00000012749
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1QB pAb (ATL-HPA052116)
Datasheet Anti C1QB pAb (ATL-HPA052116) Datasheet (External Link)
Vendor Page Anti C1QB pAb (ATL-HPA052116) at Atlas Antibodies

Documents & Links for Anti C1QB pAb (ATL-HPA052116)
Datasheet Anti C1QB pAb (ATL-HPA052116) Datasheet (External Link)
Vendor Page Anti C1QB pAb (ATL-HPA052116)