Anti C1QB pAb (ATL-HPA052116)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052116-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C1QB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036905: 77%, ENSRNOG00000012749: 77%
Entrez Gene ID: 713
Uniprot ID: P02746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKV |
Gene Sequence | PKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKV |
Gene ID - Mouse | ENSMUSG00000036905 |
Gene ID - Rat | ENSRNOG00000012749 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C1QB pAb (ATL-HPA052116) | |
Datasheet | Anti C1QB pAb (ATL-HPA052116) Datasheet (External Link) |
Vendor Page | Anti C1QB pAb (ATL-HPA052116) at Atlas Antibodies |
Documents & Links for Anti C1QB pAb (ATL-HPA052116) | |
Datasheet | Anti C1QB pAb (ATL-HPA052116) Datasheet (External Link) |
Vendor Page | Anti C1QB pAb (ATL-HPA052116) |