Anti C1QA pAb (ATL-HPA002350)

Atlas Antibodies

Catalog No.:
ATL-HPA002350-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: complement component 1, q subcomponent, A chain
Gene Name: C1QA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036887: 72%, ENSRNOG00000012807: 75%
Entrez Gene ID: 712
Uniprot ID: P02745
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFS
Gene Sequence GSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFS
Gene ID - Mouse ENSMUSG00000036887
Gene ID - Rat ENSRNOG00000012807
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1QA pAb (ATL-HPA002350)
Datasheet Anti C1QA pAb (ATL-HPA002350) Datasheet (External Link)
Vendor Page Anti C1QA pAb (ATL-HPA002350) at Atlas Antibodies

Documents & Links for Anti C1QA pAb (ATL-HPA002350)
Datasheet Anti C1QA pAb (ATL-HPA002350) Datasheet (External Link)
Vendor Page Anti C1QA pAb (ATL-HPA002350)
Citations for Anti C1QA pAb (ATL-HPA002350) – 2 Found
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Neiman, Maja; Fredolini, Claudia; Johansson, Henrik; Lehtiö, Janne; Nygren, Per-Åke; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Selectivity analysis of single binder assays used in plasma protein profiling. Proteomics. 2013;13(23-24):3406-10.  PubMed