Anti C1QA pAb (ATL-HPA002350)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002350-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C1QA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036887: 72%, ENSRNOG00000012807: 75%
Entrez Gene ID: 712
Uniprot ID: P02745
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFS |
| Gene Sequence | GSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFS |
| Gene ID - Mouse | ENSMUSG00000036887 |
| Gene ID - Rat | ENSRNOG00000012807 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1QA pAb (ATL-HPA002350) | |
| Datasheet | Anti C1QA pAb (ATL-HPA002350) Datasheet (External Link) |
| Vendor Page | Anti C1QA pAb (ATL-HPA002350) at Atlas Antibodies |
| Documents & Links for Anti C1QA pAb (ATL-HPA002350) | |
| Datasheet | Anti C1QA pAb (ATL-HPA002350) Datasheet (External Link) |
| Vendor Page | Anti C1QA pAb (ATL-HPA002350) |
| Citations for Anti C1QA pAb (ATL-HPA002350) – 2 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Neiman, Maja; Fredolini, Claudia; Johansson, Henrik; Lehtiö, Janne; Nygren, Per-Åke; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Selectivity analysis of single binder assays used in plasma protein profiling. Proteomics. 2013;13(23-24):3406-10. PubMed |