Anti C1orf74 pAb (ATL-HPA028496)

Atlas Antibodies

SKU: ATL-HPA028496-25

• 
• 
• 

Protein Description: chromosome 1 open reading frame 74
Gene Name: C1orf74
Alternative Gene Name: FLJ25078
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079144: 79%, ENSRNOG00000005558: 76%
Entrez Gene ID: 148304
Uniprot ID: Q96LT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLGYPVPYTFHLNQGDDNCLALTPLRVFTARISWLLGQPPILLYSFSVPESLFPGLRDILNTWEKDLRTRFRTQNDFADL
• Gene Sequence: LLGYPVPYTFHLNQGDDNCLALTPLRVFTARISWLLGQPPILLYSFSVPESLFPGLRDILNTWEKDLRTRFRTQNDFADL
• Gene ID - Mouse: ENSMUSG00000079144
• Gene ID - Rat: ENSRNOG00000005558
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.