Anti C1orf74 pAb (ATL-HPA028496)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028496-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C1orf74
Alternative Gene Name: FLJ25078
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079144: 79%, ENSRNOG00000005558: 76%
Entrez Gene ID: 148304
Uniprot ID: Q96LT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLGYPVPYTFHLNQGDDNCLALTPLRVFTARISWLLGQPPILLYSFSVPESLFPGLRDILNTWEKDLRTRFRTQNDFADL |
| Gene Sequence | LLGYPVPYTFHLNQGDDNCLALTPLRVFTARISWLLGQPPILLYSFSVPESLFPGLRDILNTWEKDLRTRFRTQNDFADL |
| Gene ID - Mouse | ENSMUSG00000079144 |
| Gene ID - Rat | ENSRNOG00000005558 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1orf74 pAb (ATL-HPA028496) | |
| Datasheet | Anti C1orf74 pAb (ATL-HPA028496) Datasheet (External Link) |
| Vendor Page | Anti C1orf74 pAb (ATL-HPA028496) at Atlas Antibodies |
| Documents & Links for Anti C1orf74 pAb (ATL-HPA028496) | |
| Datasheet | Anti C1orf74 pAb (ATL-HPA028496) Datasheet (External Link) |
| Vendor Page | Anti C1orf74 pAb (ATL-HPA028496) |