Anti C1orf74 pAb (ATL-HPA028496)

Atlas Antibodies

Catalog No.:
ATL-HPA028496-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 74
Gene Name: C1orf74
Alternative Gene Name: FLJ25078
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079144: 79%, ENSRNOG00000005558: 76%
Entrez Gene ID: 148304
Uniprot ID: Q96LT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLGYPVPYTFHLNQGDDNCLALTPLRVFTARISWLLGQPPILLYSFSVPESLFPGLRDILNTWEKDLRTRFRTQNDFADL
Gene Sequence LLGYPVPYTFHLNQGDDNCLALTPLRVFTARISWLLGQPPILLYSFSVPESLFPGLRDILNTWEKDLRTRFRTQNDFADL
Gene ID - Mouse ENSMUSG00000079144
Gene ID - Rat ENSRNOG00000005558
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf74 pAb (ATL-HPA028496)
Datasheet Anti C1orf74 pAb (ATL-HPA028496) Datasheet (External Link)
Vendor Page Anti C1orf74 pAb (ATL-HPA028496) at Atlas Antibodies

Documents & Links for Anti C1orf74 pAb (ATL-HPA028496)
Datasheet Anti C1orf74 pAb (ATL-HPA028496) Datasheet (External Link)
Vendor Page Anti C1orf74 pAb (ATL-HPA028496)