Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA026676-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 64
Gene Name: C1orf64
Alternative Gene Name: ERRF, MGC24047
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070637: 42%, ENSRNOG00000024693: 30%
Entrez Gene ID: 149563
Uniprot ID: Q8NEQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ
Gene Sequence HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ
Gene ID - Mouse ENSMUSG00000070637
Gene ID - Rat ENSRNOG00000024693
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation)
Datasheet Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation)
Datasheet Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation)
Citations for Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) – 2 Found
Byström, Sanna; Eklund, Martin; Hong, Mun-Gwan; Fredolini, Claudia; Eriksson, Mikael; Czene, Kamila; Hall, Per; Schwenk, Jochen M; Gabrielson, Marike. Affinity proteomic profiling of plasma for proteins associated to area-based mammographic breast density. Breast Cancer Research : Bcr. 2018;20(1):14.  PubMed
Su, Dan; Fu, Xiaoying; Fan, Songqing; Wu, Xiao; Wang, Xin-Xin; Fu, Liya; Dong, Xue-Yuan; Ni, Jianping Jenny; Fu, Li; Zhu, Zhengmao; Dong, Jin-Tang. Role of ERRF, a novel ER-related nuclear factor, in the growth control of ER-positive human breast cancer cells. The American Journal Of Pathology. 2012;180(3):1189-1201.  PubMed