Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026676-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C1orf64
Alternative Gene Name: ERRF, MGC24047
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070637: 42%, ENSRNOG00000024693: 30%
Entrez Gene ID: 149563
Uniprot ID: Q8NEQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ |
| Gene Sequence | HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ |
| Gene ID - Mouse | ENSMUSG00000070637 |
| Gene ID - Rat | ENSRNOG00000024693 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) | |
| Datasheet | Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) | |
| Datasheet | Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) |
| Citations for Anti C1orf64 pAb (ATL-HPA026676 w/enhanced validation) – 2 Found |
| Byström, Sanna; Eklund, Martin; Hong, Mun-Gwan; Fredolini, Claudia; Eriksson, Mikael; Czene, Kamila; Hall, Per; Schwenk, Jochen M; Gabrielson, Marike. Affinity proteomic profiling of plasma for proteins associated to area-based mammographic breast density. Breast Cancer Research : Bcr. 2018;20(1):14. PubMed |
| Su, Dan; Fu, Xiaoying; Fan, Songqing; Wu, Xiao; Wang, Xin-Xin; Fu, Liya; Dong, Xue-Yuan; Ni, Jianping Jenny; Fu, Li; Zhu, Zhengmao; Dong, Jin-Tang. Role of ERRF, a novel ER-related nuclear factor, in the growth control of ER-positive human breast cancer cells. The American Journal Of Pathology. 2012;180(3):1189-1201. PubMed |