Anti C1orf53 pAb (ATL-HPA065352)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065352-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C1orf53
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079283: 40%, ENSRNOG00000043374: 47%
Entrez Gene ID: 388722
Uniprot ID: Q5VUE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVS |
Gene Sequence | PPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVS |
Gene ID - Mouse | ENSMUSG00000079283 |
Gene ID - Rat | ENSRNOG00000043374 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C1orf53 pAb (ATL-HPA065352) | |
Datasheet | Anti C1orf53 pAb (ATL-HPA065352) Datasheet (External Link) |
Vendor Page | Anti C1orf53 pAb (ATL-HPA065352) at Atlas Antibodies |
Documents & Links for Anti C1orf53 pAb (ATL-HPA065352) | |
Datasheet | Anti C1orf53 pAb (ATL-HPA065352) Datasheet (External Link) |
Vendor Page | Anti C1orf53 pAb (ATL-HPA065352) |