Anti C1orf53 pAb (ATL-HPA065352)

Atlas Antibodies

Catalog No.:
ATL-HPA065352-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 53
Gene Name: C1orf53
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079283: 40%, ENSRNOG00000043374: 47%
Entrez Gene ID: 388722
Uniprot ID: Q5VUE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVS
Gene Sequence PPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVS
Gene ID - Mouse ENSMUSG00000079283
Gene ID - Rat ENSRNOG00000043374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf53 pAb (ATL-HPA065352)
Datasheet Anti C1orf53 pAb (ATL-HPA065352) Datasheet (External Link)
Vendor Page Anti C1orf53 pAb (ATL-HPA065352) at Atlas Antibodies

Documents & Links for Anti C1orf53 pAb (ATL-HPA065352)
Datasheet Anti C1orf53 pAb (ATL-HPA065352) Datasheet (External Link)
Vendor Page Anti C1orf53 pAb (ATL-HPA065352)