Anti C1orf53 pAb (ATL-HPA065352)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065352-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C1orf53
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079283: 40%, ENSRNOG00000043374: 47%
Entrez Gene ID: 388722
Uniprot ID: Q5VUE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVS |
| Gene Sequence | PPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVS |
| Gene ID - Mouse | ENSMUSG00000079283 |
| Gene ID - Rat | ENSRNOG00000043374 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1orf53 pAb (ATL-HPA065352) | |
| Datasheet | Anti C1orf53 pAb (ATL-HPA065352) Datasheet (External Link) |
| Vendor Page | Anti C1orf53 pAb (ATL-HPA065352) at Atlas Antibodies |
| Documents & Links for Anti C1orf53 pAb (ATL-HPA065352) | |
| Datasheet | Anti C1orf53 pAb (ATL-HPA065352) Datasheet (External Link) |
| Vendor Page | Anti C1orf53 pAb (ATL-HPA065352) |