Anti C1orf53 pAb (ATL-HPA065352)

Atlas Antibodies

Catalog No.: ATL-HPA065352-25

Protein Description: chromosome 1 open reading frame 53
Gene Name: C1orf53
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079283: 40%, ENSRNOG00000043374: 47%
Entrez Gene ID: 388722
Uniprot ID: Q5VUE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVS
• Gene Sequence: PPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVS
• Gene ID - Mouse: ENSMUSG00000079283
• Gene ID - Rat: ENSRNOG00000043374
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.