Anti C1orf52 pAb (ATL-HPA036072 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA036072-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 52
Gene Name: C1orf52
Alternative Gene Name: FLJ44982, gm117
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036873: 91%, ENSRNOG00000014857: 89%
Entrez Gene ID: 148423
Uniprot ID: Q8N6N3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKK
Gene Sequence PEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKK
Gene ID - Mouse ENSMUSG00000036873
Gene ID - Rat ENSRNOG00000014857
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf52 pAb (ATL-HPA036072 w/enhanced validation)
Datasheet Anti C1orf52 pAb (ATL-HPA036072 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1orf52 pAb (ATL-HPA036072 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C1orf52 pAb (ATL-HPA036072 w/enhanced validation)
Datasheet Anti C1orf52 pAb (ATL-HPA036072 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1orf52 pAb (ATL-HPA036072 w/enhanced validation)