Anti C1orf52 pAb (ATL-HPA036072 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA036072-100

• 
• 
• 

Protein Description: chromosome 1 open reading frame 52
Gene Name: C1orf52
Alternative Gene Name: FLJ44982, gm117
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036873: 91%, ENSRNOG00000014857: 89%
Entrez Gene ID: 148423
Uniprot ID: Q8N6N3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKK
• Gene Sequence: PEEPPKEFKIWKSNYVPPPETYTTEKKPPPPELDMAIKWSNIYEDNGDDAPQNAKKARLLPEGEETLESDDEKDEHTSKKRKVEPGEPAKKK
• Gene ID - Mouse: ENSMUSG00000036873
• Gene ID - Rat: ENSRNOG00000014857
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.