Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030236-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: C1orf50
Alternative Gene Name: MGC955
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078584: 86%, ENSRNOG00000027455: 86%
Entrez Gene ID: 79078
Uniprot ID: Q9BV19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH |
| Gene Sequence | HHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH |
| Gene ID - Mouse | ENSMUSG00000078584 |
| Gene ID - Rat | ENSRNOG00000027455 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation) | |
| Datasheet | Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation) | |
| Datasheet | Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation) |