Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA030236-25

• 
• 

Protein Description: chromosome 1 open reading frame 50
Gene Name: C1orf50
Alternative Gene Name: MGC955
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078584: 86%, ENSRNOG00000027455: 86%
Entrez Gene ID: 79078
Uniprot ID: Q9BV19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH
• Gene Sequence: HHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH
• Gene ID - Mouse: ENSMUSG00000078584
• Gene ID - Rat: ENSRNOG00000027455
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.