Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030236-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 50
Gene Name: C1orf50
Alternative Gene Name: MGC955
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078584: 86%, ENSRNOG00000027455: 86%
Entrez Gene ID: 79078
Uniprot ID: Q9BV19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH
Gene Sequence HHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH
Gene ID - Mouse ENSMUSG00000078584
Gene ID - Rat ENSRNOG00000027455
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation)
Datasheet Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation)
Datasheet Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1orf50 pAb (ATL-HPA030236 w/enhanced validation)