Anti C1orf43 pAb (ATL-HPA010725)

Atlas Antibodies

SKU: ATL-HPA010725-25

• 

Protein Description: chromosome 1 open reading frame 43
Gene Name: C1orf43
Alternative Gene Name: DKFZp586G1722, NICE-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027942: 97%, ENSRNOG00000017758: 96%
Entrez Gene ID: 25912
Uniprot ID: Q9BWL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTS
• Gene Sequence: AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTS
• Gene ID - Mouse: ENSMUSG00000027942
• Gene ID - Rat: ENSRNOG00000017758
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.