Anti C1orf43 pAb (ATL-HPA010725)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010725-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C1orf43
Alternative Gene Name: DKFZp586G1722, NICE-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027942: 97%, ENSRNOG00000017758: 96%
Entrez Gene ID: 25912
Uniprot ID: Q9BWL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTS |
| Gene Sequence | AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTS |
| Gene ID - Mouse | ENSMUSG00000027942 |
| Gene ID - Rat | ENSRNOG00000017758 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1orf43 pAb (ATL-HPA010725) | |
| Datasheet | Anti C1orf43 pAb (ATL-HPA010725) Datasheet (External Link) |
| Vendor Page | Anti C1orf43 pAb (ATL-HPA010725) at Atlas Antibodies |
| Documents & Links for Anti C1orf43 pAb (ATL-HPA010725) | |
| Datasheet | Anti C1orf43 pAb (ATL-HPA010725) Datasheet (External Link) |
| Vendor Page | Anti C1orf43 pAb (ATL-HPA010725) |