Anti C1orf43 pAb (ATL-HPA010725)

Atlas Antibodies

Catalog No.:
ATL-HPA010725-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 43
Gene Name: C1orf43
Alternative Gene Name: DKFZp586G1722, NICE-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027942: 97%, ENSRNOG00000017758: 96%
Entrez Gene ID: 25912
Uniprot ID: Q9BWL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTS
Gene Sequence AMKSRRGPHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTS
Gene ID - Mouse ENSMUSG00000027942
Gene ID - Rat ENSRNOG00000017758
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf43 pAb (ATL-HPA010725)
Datasheet Anti C1orf43 pAb (ATL-HPA010725) Datasheet (External Link)
Vendor Page Anti C1orf43 pAb (ATL-HPA010725) at Atlas Antibodies

Documents & Links for Anti C1orf43 pAb (ATL-HPA010725)
Datasheet Anti C1orf43 pAb (ATL-HPA010725) Datasheet (External Link)
Vendor Page Anti C1orf43 pAb (ATL-HPA010725)