Anti C1orf27 pAb (ATL-HPA015988)

Atlas Antibodies

SKU:
ATL-HPA015988-25
  • Immunohistochemical staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
  • Western blot analysis in human cell line K562.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 27
Gene Name: C1orf27
Alternative Gene Name: FLJ20505, odr-4, TTG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006010: 81%, ENSRNOG00000002473: 78%
Entrez Gene ID: 54953
Uniprot ID: Q5SWX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIK
Gene Sequence FHVLPYRVFVPLPGSTVMLCDYKFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPIK
Gene ID - Mouse ENSMUSG00000006010
Gene ID - Rat ENSRNOG00000002473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C1orf27 pAb (ATL-HPA015988)
Datasheet Anti C1orf27 pAb (ATL-HPA015988) Datasheet (External Link)
Vendor Page Anti C1orf27 pAb (ATL-HPA015988) at Atlas Antibodies

Documents & Links for Anti C1orf27 pAb (ATL-HPA015988)
Datasheet Anti C1orf27 pAb (ATL-HPA015988) Datasheet (External Link)
Vendor Page Anti C1orf27 pAb (ATL-HPA015988)