Anti C1orf228 pAb (ATL-HPA034769)

Atlas Antibodies

Catalog No.:
ATL-HPA034769-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 228
Gene Name: C1orf228
Alternative Gene Name: MGC33556, NCRNA00082, p40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060268: 76%, ENSRNOG00000031494: 73%
Entrez Gene ID: 339541
Uniprot ID: Q6PIY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQLTPSLPMF
Gene Sequence VLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQLTPSLPMF
Gene ID - Mouse ENSMUSG00000060268
Gene ID - Rat ENSRNOG00000031494
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf228 pAb (ATL-HPA034769)
Datasheet Anti C1orf228 pAb (ATL-HPA034769) Datasheet (External Link)
Vendor Page Anti C1orf228 pAb (ATL-HPA034769) at Atlas Antibodies

Documents & Links for Anti C1orf228 pAb (ATL-HPA034769)
Datasheet Anti C1orf228 pAb (ATL-HPA034769) Datasheet (External Link)
Vendor Page Anti C1orf228 pAb (ATL-HPA034769)