Anti C1orf228 pAb (ATL-HPA034769)

Atlas Antibodies

Catalog No.: ATL-HPA034769-25

Protein Description: chromosome 1 open reading frame 228
Gene Name: C1orf228
Alternative Gene Name: MGC33556, NCRNA00082, p40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060268: 76%, ENSRNOG00000031494: 73%
Entrez Gene ID: 339541
Uniprot ID: Q6PIY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQLTPSLPMF
• Gene Sequence: VLGTMHLEVQYEAIELIKDLVGYDVRQALLKGLVALLIPSVKEISKLQAKILSDPSVLQLTPSLPMF
• Gene ID - Mouse: ENSMUSG00000060268
• Gene ID - Rat: ENSRNOG00000031494
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.