Anti C1orf226 pAb (ATL-HPA074060)

Atlas Antibodies

Catalog No.:
ATL-HPA074060-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 226
Gene Name: C1orf226
Alternative Gene Name: FLJ13137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102752: 78%, ENSRNOG00000042929: 75%
Entrez Gene ID: 400793
Uniprot ID: A1L170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MFENLNTALTPKLQASRSFPHLSKPVAPGSAPLGSG
Gene Sequence MFENLNTALTPKLQASRSFPHLSKPVAPGSAPLGSG
Gene ID - Mouse ENSMUSG00000102752
Gene ID - Rat ENSRNOG00000042929
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf226 pAb (ATL-HPA074060)
Datasheet Anti C1orf226 pAb (ATL-HPA074060) Datasheet (External Link)
Vendor Page Anti C1orf226 pAb (ATL-HPA074060) at Atlas Antibodies

Documents & Links for Anti C1orf226 pAb (ATL-HPA074060)
Datasheet Anti C1orf226 pAb (ATL-HPA074060) Datasheet (External Link)
Vendor Page Anti C1orf226 pAb (ATL-HPA074060)