Anti C1orf226 pAb (ATL-HPA074060)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074060-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C1orf226
Alternative Gene Name: FLJ13137
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000102752: 78%, ENSRNOG00000042929: 75%
Entrez Gene ID: 400793
Uniprot ID: A1L170
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MFENLNTALTPKLQASRSFPHLSKPVAPGSAPLGSG |
Gene Sequence | MFENLNTALTPKLQASRSFPHLSKPVAPGSAPLGSG |
Gene ID - Mouse | ENSMUSG00000102752 |
Gene ID - Rat | ENSRNOG00000042929 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C1orf226 pAb (ATL-HPA074060) | |
Datasheet | Anti C1orf226 pAb (ATL-HPA074060) Datasheet (External Link) |
Vendor Page | Anti C1orf226 pAb (ATL-HPA074060) at Atlas Antibodies |
Documents & Links for Anti C1orf226 pAb (ATL-HPA074060) | |
Datasheet | Anti C1orf226 pAb (ATL-HPA074060) Datasheet (External Link) |
Vendor Page | Anti C1orf226 pAb (ATL-HPA074060) |