Anti C1orf216 pAb (ATL-HPA028299)

Atlas Antibodies

SKU:
ATL-HPA028299-25
  • Immunohistochemical staining of human cervix shows strong cytoplasmic positivity in squamous epithelial cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C1orf216 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407621).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 216
Gene Name: C1orf216
Alternative Gene Name: FLJ38984
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073755: 74%, ENSRNOG00000048060: 71%
Entrez Gene ID: 127703
Uniprot ID: Q8TAB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MFAIQPGLAEGGQFLGDPPPGLCQPELQPDSNSNFMASAKDANENWHGMPGRVEPILRRSSSESPSDNQA
Gene Sequence MFAIQPGLAEGGQFLGDPPPGLCQPELQPDSNSNFMASAKDANENWHGMPGRVEPILRRSSSESPSDNQA
Gene ID - Mouse ENSMUSG00000073755
Gene ID - Rat ENSRNOG00000048060
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C1orf216 pAb (ATL-HPA028299)
Datasheet Anti C1orf216 pAb (ATL-HPA028299) Datasheet (External Link)
Vendor Page Anti C1orf216 pAb (ATL-HPA028299) at Atlas Antibodies

Documents & Links for Anti C1orf216 pAb (ATL-HPA028299)
Datasheet Anti C1orf216 pAb (ATL-HPA028299) Datasheet (External Link)
Vendor Page Anti C1orf216 pAb (ATL-HPA028299)