Anti C1orf210 pAb (ATL-HPA013788 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA013788-100
  • Immunohistochemical staining of human kidney shows nucleolar positivity in renal tubules.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and C1orf210 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405533).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 210
Gene Name: C1orf210
Alternative Gene Name: MGC52423
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028536: 79%, ENSRNOG00000020259: 77%
Entrez Gene ID: 149466
Uniprot ID: Q8IVY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RYHASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHF
Gene Sequence RYHASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHF
Gene ID - Mouse ENSMUSG00000028536
Gene ID - Rat ENSRNOG00000020259
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C1orf210 pAb (ATL-HPA013788 w/enhanced validation)
Datasheet Anti C1orf210 pAb (ATL-HPA013788 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1orf210 pAb (ATL-HPA013788 w/enhanced validation)