Anti C1orf210 pAb (ATL-HPA013788 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA013788-100

Protein Description: chromosome 1 open reading frame 210
Gene Name: C1orf210
Alternative Gene Name: MGC52423
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028536: 79%, ENSRNOG00000020259: 77%
Entrez Gene ID: 149466
Uniprot ID: Q8IVY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RYHASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHF
• Gene Sequence: RYHASYRHRPLPETGRGGRPQVAEDEDDDGFIEDNYIQPGTGELGTEGSRDHF
• Gene ID - Mouse: ENSMUSG00000028536
• Gene ID - Rat: ENSRNOG00000020259
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.