Anti C1orf204 pAb (ATL-HPA051028)

Atlas Antibodies

Catalog No.:
ATL-HPA051028-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 204
Gene Name: C1orf204
Alternative Gene Name: FLJ39187
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050141: 29%, ENSRNOG00000056617: 29%
Entrez Gene ID: 284677
Uniprot ID: Q5VU13
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGVDFPQVSAWMRALPSPDCPGLRTTGEQMQKLLLKENKVKTRKSKRRSGEGSHLTTSILEQ
Gene Sequence SGVDFPQVSAWMRALPSPDCPGLRTTGEQMQKLLLKENKVKTRKSKRRSGEGSHLTTSILEQ
Gene ID - Mouse ENSMUSG00000050141
Gene ID - Rat ENSRNOG00000056617
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf204 pAb (ATL-HPA051028)
Datasheet Anti C1orf204 pAb (ATL-HPA051028) Datasheet (External Link)
Vendor Page Anti C1orf204 pAb (ATL-HPA051028) at Atlas Antibodies

Documents & Links for Anti C1orf204 pAb (ATL-HPA051028)
Datasheet Anti C1orf204 pAb (ATL-HPA051028) Datasheet (External Link)
Vendor Page Anti C1orf204 pAb (ATL-HPA051028)