Anti C1orf174 pAb (ATL-HPA008270)

Atlas Antibodies

Catalog No.:
ATL-HPA008270-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 174
Gene Name: C1orf174
Alternative Gene Name: RP13-531C17.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047613: 63%, ENSRNOG00000025034: 63%
Entrez Gene ID: 339448
Uniprot ID: Q8IYL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQKQNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVSRFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAKDDDDDDDDD
Gene Sequence VSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQKQNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVSRFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAKDDDDDDDDD
Gene ID - Mouse ENSMUSG00000047613
Gene ID - Rat ENSRNOG00000025034
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf174 pAb (ATL-HPA008270)
Datasheet Anti C1orf174 pAb (ATL-HPA008270) Datasheet (External Link)
Vendor Page Anti C1orf174 pAb (ATL-HPA008270) at Atlas Antibodies

Documents & Links for Anti C1orf174 pAb (ATL-HPA008270)
Datasheet Anti C1orf174 pAb (ATL-HPA008270) Datasheet (External Link)
Vendor Page Anti C1orf174 pAb (ATL-HPA008270)
Citations for Anti C1orf174 pAb (ATL-HPA008270) – 2 Found
Fagerberg, Linn; Stadler, Charlotte; Skogs, Marie; Hjelmare, Martin; Jonasson, Kalle; Wiking, Mikaela; Abergh, Annica; Uhlén, Mathias; Lundberg, Emma. Mapping the subcellular protein distribution in three human cell lines. Journal Of Proteome Research. 2011;10(8):3766-77.  PubMed
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed