Anti C1orf167 pAb (ATL-HPA039114)

Atlas Antibodies

Catalog No.: ATL-HPA039114-25

Protein Description: chromosome 1 open reading frame 167
Gene Name: C1orf167
Alternative Gene Name: DKFZp434E1410, RP11-56N19.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054128: 27%, ENSRNOG00000031090: 30%
Entrez Gene ID:
Uniprot ID: Q5SNV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WCEVVRDTGVLRAQHQAFQDGLRRRALGAVFATWREAQEVAAGAQEQRVAQASLARWRSCGQQGQEDGQQK
• Gene Sequence: WCEVVRDTGVLRAQHQAFQDGLRRRALGAVFATWREAQEVAAGAQEQRVAQASLARWRSCGQQGQEDGQQK
• Gene ID - Mouse: ENSMUSG00000054128
• Gene ID - Rat: ENSRNOG00000031090
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.