Anti C1orf167 pAb (ATL-HPA039114)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039114-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: C1orf167
Alternative Gene Name: DKFZp434E1410, RP11-56N19.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054128: 27%, ENSRNOG00000031090: 30%
Entrez Gene ID:
Uniprot ID: Q5SNV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WCEVVRDTGVLRAQHQAFQDGLRRRALGAVFATWREAQEVAAGAQEQRVAQASLARWRSCGQQGQEDGQQK |
| Gene Sequence | WCEVVRDTGVLRAQHQAFQDGLRRRALGAVFATWREAQEVAAGAQEQRVAQASLARWRSCGQQGQEDGQQK |
| Gene ID - Mouse | ENSMUSG00000054128 |
| Gene ID - Rat | ENSRNOG00000031090 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1orf167 pAb (ATL-HPA039114) | |
| Datasheet | Anti C1orf167 pAb (ATL-HPA039114) Datasheet (External Link) |
| Vendor Page | Anti C1orf167 pAb (ATL-HPA039114) at Atlas Antibodies |
| Documents & Links for Anti C1orf167 pAb (ATL-HPA039114) | |
| Datasheet | Anti C1orf167 pAb (ATL-HPA039114) Datasheet (External Link) |
| Vendor Page | Anti C1orf167 pAb (ATL-HPA039114) |