Anti C1orf159 pAb (ATL-HPA075399)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075399-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C1orf159
Alternative Gene Name: FLJ20584
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059939: 63%, ENSRNOG00000020199: 64%
Entrez Gene ID: 54991
Uniprot ID: Q96HA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLPVVREWALTHTAQLPECCVDVVGVNASCPGASLCGPGCYRRWNADGSASCVRCGNGTLPAYNGSECRSFAG |
| Gene Sequence | SLPVVREWALTHTAQLPECCVDVVGVNASCPGASLCGPGCYRRWNADGSASCVRCGNGTLPAYNGSECRSFAG |
| Gene ID - Mouse | ENSMUSG00000059939 |
| Gene ID - Rat | ENSRNOG00000020199 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1orf159 pAb (ATL-HPA075399) | |
| Datasheet | Anti C1orf159 pAb (ATL-HPA075399) Datasheet (External Link) |
| Vendor Page | Anti C1orf159 pAb (ATL-HPA075399) at Atlas Antibodies |
| Documents & Links for Anti C1orf159 pAb (ATL-HPA075399) | |
| Datasheet | Anti C1orf159 pAb (ATL-HPA075399) Datasheet (External Link) |
| Vendor Page | Anti C1orf159 pAb (ATL-HPA075399) |