Anti C1orf159 pAb (ATL-HPA075399)

Atlas Antibodies

Catalog No.:
ATL-HPA075399-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 159
Gene Name: C1orf159
Alternative Gene Name: FLJ20584
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059939: 63%, ENSRNOG00000020199: 64%
Entrez Gene ID: 54991
Uniprot ID: Q96HA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLPVVREWALTHTAQLPECCVDVVGVNASCPGASLCGPGCYRRWNADGSASCVRCGNGTLPAYNGSECRSFAG
Gene Sequence SLPVVREWALTHTAQLPECCVDVVGVNASCPGASLCGPGCYRRWNADGSASCVRCGNGTLPAYNGSECRSFAG
Gene ID - Mouse ENSMUSG00000059939
Gene ID - Rat ENSRNOG00000020199
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1orf159 pAb (ATL-HPA075399)
Datasheet Anti C1orf159 pAb (ATL-HPA075399) Datasheet (External Link)
Vendor Page Anti C1orf159 pAb (ATL-HPA075399) at Atlas Antibodies

Documents & Links for Anti C1orf159 pAb (ATL-HPA075399)
Datasheet Anti C1orf159 pAb (ATL-HPA075399) Datasheet (External Link)
Vendor Page Anti C1orf159 pAb (ATL-HPA075399)