Anti C1orf131 pAb (ATL-HPA028452 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA028452-25
  • Immunohistochemical staining of human duodenum shows cytoplasmic and nucleoli positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
  • Western blot analysis using Anti-C1orf131 antibody HPA028452 (A) shows similar pattern to independent antibody HPA029920 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 131
Gene Name: C1orf131
Alternative Gene Name: DKFZp547B1713
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031984: 51%, ENSRNOG00000019169: 54%
Entrez Gene ID: 128061
Uniprot ID: Q8NDD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADPTMSQEQGPGSSTPPSSPTLLDALLQNLYDFGGTEGETEQKKIIKKRENKKRDVMASAALAAEPSPLPGS
Gene Sequence ADPTMSQEQGPGSSTPPSSPTLLDALLQNLYDFGGTEGETEQKKIIKKRENKKRDVMASAALAAEPSPLPGS
Gene ID - Mouse ENSMUSG00000031984
Gene ID - Rat ENSRNOG00000019169
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C1orf131 pAb (ATL-HPA028452 w/enhanced validation)
Datasheet Anti C1orf131 pAb (ATL-HPA028452 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1orf131 pAb (ATL-HPA028452 w/enhanced validation)