Anti C1orf112 pAb (ATL-HPA023778)

Atlas Antibodies

SKU:
ATL-HPA023778-25
  • Immunohistochemical staining of human testis shows strong nuclear positivity in Leydig cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 112
Gene Name: C1orf112
Alternative Gene Name: FLJ10706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041406: 74%, ENSRNOG00000059276: 68%
Entrez Gene ID: 55732
Uniprot ID: Q9NSG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCMFALLLADRSWLLEQHTLEAFTQFAEGTNHEEIVPQCLSSEETKNKVVSFLEKTGFVDETEAAKVERVKQEKGIFWEPF
Gene Sequence SCMFALLLADRSWLLEQHTLEAFTQFAEGTNHEEIVPQCLSSEETKNKVVSFLEKTGFVDETEAAKVERVKQEKGIFWEPF
Gene ID - Mouse ENSMUSG00000041406
Gene ID - Rat ENSRNOG00000059276
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C1orf112 pAb (ATL-HPA023778)
Datasheet Anti C1orf112 pAb (ATL-HPA023778) Datasheet (External Link)
Vendor Page Anti C1orf112 pAb (ATL-HPA023778) at Atlas Antibodies

Documents & Links for Anti C1orf112 pAb (ATL-HPA023778)
Datasheet Anti C1orf112 pAb (ATL-HPA023778) Datasheet (External Link)
Vendor Page Anti C1orf112 pAb (ATL-HPA023778)