Anti C1orf112 pAb (ATL-HPA023778)

Atlas Antibodies

Catalog No.: ATL-HPA023778-25

Protein Description: chromosome 1 open reading frame 112
Gene Name: C1orf112
Alternative Gene Name: FLJ10706
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041406: 74%, ENSRNOG00000059276: 68%
Entrez Gene ID: 55732
Uniprot ID: Q9NSG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SCMFALLLADRSWLLEQHTLEAFTQFAEGTNHEEIVPQCLSSEETKNKVVSFLEKTGFVDETEAAKVERVKQEKGIFWEPF
• Gene Sequence: SCMFALLLADRSWLLEQHTLEAFTQFAEGTNHEEIVPQCLSSEETKNKVVSFLEKTGFVDETEAAKVERVKQEKGIFWEPF
• Gene ID - Mouse: ENSMUSG00000041406
• Gene ID - Rat: ENSRNOG00000059276
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.