Anti C1orf109 pAb (ATL-HPA027110)

Atlas Antibodies

SKU:
ATL-HPA027110-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells of renal tubles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 1 open reading frame 109
Gene Name: C1orf109
Alternative Gene Name: FLJ20508
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032489: 26%, ENSRNOG00000025065: 82%
Entrez Gene ID: 54955
Uniprot ID: Q9NX04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DMLEWLQDIERHYRKSYLKRKYLLSSIQWGDLANIQALPKAWDRISKDEHQDLVQDILLNVSFFLEE
Gene Sequence DMLEWLQDIERHYRKSYLKRKYLLSSIQWGDLANIQALPKAWDRISKDEHQDLVQDILLNVSFFLEE
Gene ID - Mouse ENSMUSG00000032489
Gene ID - Rat ENSRNOG00000025065
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C1orf109 pAb (ATL-HPA027110)
Datasheet Anti C1orf109 pAb (ATL-HPA027110) Datasheet (External Link)
Vendor Page Anti C1orf109 pAb (ATL-HPA027110) at Atlas Antibodies

Documents & Links for Anti C1orf109 pAb (ATL-HPA027110)
Datasheet Anti C1orf109 pAb (ATL-HPA027110) Datasheet (External Link)
Vendor Page Anti C1orf109 pAb (ATL-HPA027110)