Anti C1GALT1C1 pAb (ATL-HPA015632)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015632-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C1GALT1C1
Alternative Gene Name: C1GALT2, COSMC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048970: 94%, ENSRNOG00000002536: 94%
Entrez Gene ID: 29071
Uniprot ID: Q96EU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIE |
| Gene Sequence | NRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIE |
| Gene ID - Mouse | ENSMUSG00000048970 |
| Gene ID - Rat | ENSRNOG00000002536 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1GALT1C1 pAb (ATL-HPA015632) | |
| Datasheet | Anti C1GALT1C1 pAb (ATL-HPA015632) Datasheet (External Link) |
| Vendor Page | Anti C1GALT1C1 pAb (ATL-HPA015632) at Atlas Antibodies |
| Documents & Links for Anti C1GALT1C1 pAb (ATL-HPA015632) | |
| Datasheet | Anti C1GALT1C1 pAb (ATL-HPA015632) Datasheet (External Link) |
| Vendor Page | Anti C1GALT1C1 pAb (ATL-HPA015632) |