Anti C1GALT1C1 pAb (ATL-HPA015632)

Atlas Antibodies

Catalog No.: ATL-HPA015632-25

Protein Description: C1GALT1-specific chaperone 1
Gene Name: C1GALT1C1
Alternative Gene Name: C1GALT2, COSMC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048970: 94%, ENSRNOG00000002536: 94%
Entrez Gene ID: 29071
Uniprot ID: Q96EU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIE
• Gene Sequence: NRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIE
• Gene ID - Mouse: ENSMUSG00000048970
• Gene ID - Rat: ENSRNOG00000002536
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.