Anti C1GALT1C1 pAb (ATL-HPA015632)

Atlas Antibodies

Catalog No.:
ATL-HPA015632-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: C1GALT1-specific chaperone 1
Gene Name: C1GALT1C1
Alternative Gene Name: C1GALT2, COSMC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048970: 94%, ENSRNOG00000002536: 94%
Entrez Gene ID: 29071
Uniprot ID: Q96EU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIE
Gene Sequence NRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIE
Gene ID - Mouse ENSMUSG00000048970
Gene ID - Rat ENSRNOG00000002536
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1GALT1C1 pAb (ATL-HPA015632)
Datasheet Anti C1GALT1C1 pAb (ATL-HPA015632) Datasheet (External Link)
Vendor Page Anti C1GALT1C1 pAb (ATL-HPA015632) at Atlas Antibodies

Documents & Links for Anti C1GALT1C1 pAb (ATL-HPA015632)
Datasheet Anti C1GALT1C1 pAb (ATL-HPA015632) Datasheet (External Link)
Vendor Page Anti C1GALT1C1 pAb (ATL-HPA015632)