Anti C1GALT1 pAb (ATL-HPA012819 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA012819-25
  • Immunohistochemical staining of human cerebral cortex, kidney, liver and parathyroid gland using Anti-C1GALT1 antibody HPA012819 (A) shows similar protein distribution across tissues to independent antibody HPA011294 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies & cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Gene Name: C1GALT1
Alternative Gene Name: C1GALT, T-synthase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042460: 92%, ENSRNOG00000007804: 92%
Entrez Gene ID: 56913
Uniprot ID: Q9NS00
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDS
Gene Sequence SKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDS
Gene ID - Mouse ENSMUSG00000042460
Gene ID - Rat ENSRNOG00000007804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti C1GALT1 pAb (ATL-HPA012819 w/enhanced validation)
Datasheet Anti C1GALT1 pAb (ATL-HPA012819 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C1GALT1 pAb (ATL-HPA012819 w/enhanced validation)