Anti C1D pAb (ATL-HPA037588)

Atlas Antibodies

Catalog No.:
ATL-HPA037588-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: C1D nuclear receptor corepressor
Gene Name: C1D
Alternative Gene Name: LRP1, SUN-CoR, SUNCOR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000581: 88%, ENSRNOG00000005982: 88%
Entrez Gene ID: 10438
Uniprot ID: Q13901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMF
Gene Sequence MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMF
Gene ID - Mouse ENSMUSG00000000581
Gene ID - Rat ENSRNOG00000005982
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C1D pAb (ATL-HPA037588)
Datasheet Anti C1D pAb (ATL-HPA037588) Datasheet (External Link)
Vendor Page Anti C1D pAb (ATL-HPA037588) at Atlas Antibodies

Documents & Links for Anti C1D pAb (ATL-HPA037588)
Datasheet Anti C1D pAb (ATL-HPA037588) Datasheet (External Link)
Vendor Page Anti C1D pAb (ATL-HPA037588)