Anti C1D pAb (ATL-HPA037588)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037588-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C1D
Alternative Gene Name: LRP1, SUN-CoR, SUNCOR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000581: 88%, ENSRNOG00000005982: 88%
Entrez Gene ID: 10438
Uniprot ID: Q13901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMF |
| Gene Sequence | MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMF |
| Gene ID - Mouse | ENSMUSG00000000581 |
| Gene ID - Rat | ENSRNOG00000005982 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C1D pAb (ATL-HPA037588) | |
| Datasheet | Anti C1D pAb (ATL-HPA037588) Datasheet (External Link) |
| Vendor Page | Anti C1D pAb (ATL-HPA037588) at Atlas Antibodies |
| Documents & Links for Anti C1D pAb (ATL-HPA037588) | |
| Datasheet | Anti C1D pAb (ATL-HPA037588) Datasheet (External Link) |
| Vendor Page | Anti C1D pAb (ATL-HPA037588) |