Anti C1D pAb (ATL-HPA037588)

Atlas Antibodies

SKU: ATL-HPA037588-25

• 

Protein Description: C1D nuclear receptor corepressor
Gene Name: C1D
Alternative Gene Name: LRP1, SUN-CoR, SUNCOR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000581: 88%, ENSRNOG00000005982: 88%
Entrez Gene ID: 10438
Uniprot ID: Q13901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMF
• Gene Sequence: MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMF
• Gene ID - Mouse: ENSMUSG00000000581
• Gene ID - Rat: ENSRNOG00000005982
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.