Anti C1D pAb (ATL-HPA037413)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037413-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C1D
Alternative Gene Name: LRP1, SUN-CoR, SUNCOR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000581: 93%, ENSRNOG00000005982: 94%
Entrez Gene ID: 10438
Uniprot ID: Q13901
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGK |
Gene Sequence | ATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGK |
Gene ID - Mouse | ENSMUSG00000000581 |
Gene ID - Rat | ENSRNOG00000005982 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C1D pAb (ATL-HPA037413) | |
Datasheet | Anti C1D pAb (ATL-HPA037413) Datasheet (External Link) |
Vendor Page | Anti C1D pAb (ATL-HPA037413) at Atlas Antibodies |
Documents & Links for Anti C1D pAb (ATL-HPA037413) | |
Datasheet | Anti C1D pAb (ATL-HPA037413) Datasheet (External Link) |
Vendor Page | Anti C1D pAb (ATL-HPA037413) |