Anti C19orf84 pAb (ATL-HPA068082)

Atlas Antibodies

SKU:
ATL-HPA068082-25
  • Immunohistochemical staining of human testis shows moderate positivity in cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 84
Gene Name: C19orf84
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093639: 67%, ENSRNOG00000010881: 29%
Entrez Gene ID: 147646
Uniprot ID: I3L1E1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWE
Gene Sequence PPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWE
Gene ID - Mouse ENSMUSG00000093639
Gene ID - Rat ENSRNOG00000010881
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti C19orf84 pAb (ATL-HPA068082)
Datasheet Anti C19orf84 pAb (ATL-HPA068082) Datasheet (External Link)
Vendor Page Anti C19orf84 pAb (ATL-HPA068082) at Atlas Antibodies

Documents & Links for Anti C19orf84 pAb (ATL-HPA068082)
Datasheet Anti C19orf84 pAb (ATL-HPA068082) Datasheet (External Link)
Vendor Page Anti C19orf84 pAb (ATL-HPA068082)