Anti C19orf73 pAb (ATL-HPA062719)

Atlas Antibodies

Catalog No.:
ATL-HPA062719-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 73
Gene Name: C19orf73
Alternative Gene Name: FLJ10490
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033256: 35%, ENSRNOG00000021041: 33%
Entrez Gene ID: 55150
Uniprot ID: Q9NVV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQT
Gene Sequence MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQT
Gene ID - Mouse ENSMUSG00000033256
Gene ID - Rat ENSRNOG00000021041
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf73 pAb (ATL-HPA062719)
Datasheet Anti C19orf73 pAb (ATL-HPA062719) Datasheet (External Link)
Vendor Page Anti C19orf73 pAb (ATL-HPA062719) at Atlas Antibodies

Documents & Links for Anti C19orf73 pAb (ATL-HPA062719)
Datasheet Anti C19orf73 pAb (ATL-HPA062719) Datasheet (External Link)
Vendor Page Anti C19orf73 pAb (ATL-HPA062719)