Anti C19orf73 pAb (ATL-HPA062719)

Atlas Antibodies

Catalog No.: ATL-HPA062719-25

Protein Description: chromosome 19 open reading frame 73
Gene Name: C19orf73
Alternative Gene Name: FLJ10490
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033256: 35%, ENSRNOG00000021041: 33%
Entrez Gene ID: 55150
Uniprot ID: Q9NVV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQT
• Gene Sequence: MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQT
• Gene ID - Mouse: ENSMUSG00000033256
• Gene ID - Rat: ENSRNOG00000021041
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.