Anti C19orf70 pAb (ATL-HPA042672)

Atlas Antibodies

Catalog No.:
ATL-HPA042672-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 70
Gene Name: C19orf70
Alternative Gene Name: P117, QIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049760: 86%, ENSRNOG00000012148: 23%
Entrez Gene ID: 125988
Uniprot ID: Q5XKP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VYLVYDQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVK
Gene Sequence VYLVYDQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVK
Gene ID - Mouse ENSMUSG00000049760
Gene ID - Rat ENSRNOG00000012148
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf70 pAb (ATL-HPA042672)
Datasheet Anti C19orf70 pAb (ATL-HPA042672) Datasheet (External Link)
Vendor Page Anti C19orf70 pAb (ATL-HPA042672) at Atlas Antibodies

Documents & Links for Anti C19orf70 pAb (ATL-HPA042672)
Datasheet Anti C19orf70 pAb (ATL-HPA042672) Datasheet (External Link)
Vendor Page Anti C19orf70 pAb (ATL-HPA042672)