Anti C19orf68 pAb (ATL-HPA061028)

Atlas Antibodies

Catalog No.:
ATL-HPA061028-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 68
Gene Name: C19orf68
Alternative Gene Name: LOC374920
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070814: 90%, ENSRNOG00000014186: 87%
Entrez Gene ID: 374920
Uniprot ID: Q86XI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRLLSYCKGRDHGVLDALHVLEGLFRTDPEAKVKLVFVEDQAVVETVFFLTSRTRALLRRFPRMLLVDRL
Gene Sequence RRLLSYCKGRDHGVLDALHVLEGLFRTDPEAKVKLVFVEDQAVVETVFFLTSRTRALLRRFPRMLLVDRL
Gene ID - Mouse ENSMUSG00000070814
Gene ID - Rat ENSRNOG00000014186
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf68 pAb (ATL-HPA061028)
Datasheet Anti C19orf68 pAb (ATL-HPA061028) Datasheet (External Link)
Vendor Page Anti C19orf68 pAb (ATL-HPA061028) at Atlas Antibodies

Documents & Links for Anti C19orf68 pAb (ATL-HPA061028)
Datasheet Anti C19orf68 pAb (ATL-HPA061028) Datasheet (External Link)
Vendor Page Anti C19orf68 pAb (ATL-HPA061028)