Anti C19orf66 pAb (ATL-HPA042001 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA042001-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C19orf66
Alternative Gene Name: FLJ11286
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038884: 95%, ENSRNOG00000020580: 95%
Entrez Gene ID: 55337
Uniprot ID: Q9NUL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KFHGKASSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDD |
Gene Sequence | KFHGKASSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDD |
Gene ID - Mouse | ENSMUSG00000038884 |
Gene ID - Rat | ENSRNOG00000020580 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C19orf66 pAb (ATL-HPA042001 w/enhanced validation) | |
Datasheet | Anti C19orf66 pAb (ATL-HPA042001 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C19orf66 pAb (ATL-HPA042001 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti C19orf66 pAb (ATL-HPA042001 w/enhanced validation) | |
Datasheet | Anti C19orf66 pAb (ATL-HPA042001 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti C19orf66 pAb (ATL-HPA042001 w/enhanced validation) |
Citations for Anti C19orf66 pAb (ATL-HPA042001 w/enhanced validation) – 2 Found |
Balinsky, Corey A; Schmeisser, Hana; Wells, Alexandra I; Ganesan, Sundar; Jin, Tengchuan; Singh, Kavita; Zoon, Kathryn C. IRAV (FLJ11286), an Interferon-Stimulated Gene with Antiviral Activity against Dengue Virus, Interacts with MOV10. Journal Of Virology. 2017;91(5) PubMed |
Napthine, Sawsan; Hill, Chris H; Nugent, Holly C M; Brierley, Ian. Modulation of Viral Programmed Ribosomal Frameshifting and Stop Codon Readthrough by the Host Restriction Factor Shiftless. Viruses. 2021;13(7) PubMed |