Anti C19orf66 pAb (ATL-HPA042001 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA042001-25

• 
• 
• 

Protein Description: chromosome 19 open reading frame 66
Gene Name: C19orf66
Alternative Gene Name: FLJ11286
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038884: 95%, ENSRNOG00000020580: 95%
Entrez Gene ID: 55337
Uniprot ID: Q9NUL5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KFHGKASSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDD
• Gene Sequence: KFHGKASSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDD
• Gene ID - Mouse: ENSMUSG00000038884
• Gene ID - Rat: ENSRNOG00000020580
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti C19orf66 pAb (ATL-HPA042001 w/enhanced validation) – 2 Found

Balinsky, Corey A; Schmeisser, Hana; Wells, Alexandra I; Ganesan, Sundar; Jin, Tengchuan; Singh, Kavita; Zoon, Kathryn C. IRAV (FLJ11286), an Interferon-Stimulated Gene with Antiviral Activity against Dengue Virus, Interacts with MOV10. Journal Of Virology. 2017;91(5) 

Napthine, Sawsan; Hill, Chris H; Nugent, Holly C M; Brierley, Ian. Modulation of Viral Programmed Ribosomal Frameshifting and Stop Codon Readthrough by the Host Restriction Factor Shiftless. Viruses. 2021;13(7)