Anti C19orf60 pAb (ATL-HPA043414)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA043414-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $395.00
    
         
                            Gene Name: C19orf60
Alternative Gene Name: FLJ20850, FLJ30108, FLJ34606, FLJ37391
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058833: 69%, ENSRNOG00000017692: 29%
Entrez Gene ID: 55049
Uniprot ID: Q96EN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | TVALLQLMETPELAGQEDAVRMQQLKMKVIKTMEAISEVLQDLRFDAESAE | 
| Gene Sequence | TVALLQLMETPELAGQEDAVRMQQLKMKVIKTMEAISEVLQDLRFDAESAE | 
| Gene ID - Mouse | ENSMUSG00000058833 | 
| Gene ID - Rat | ENSRNOG00000017692 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti C19orf60 pAb (ATL-HPA043414) | |
| Datasheet | Anti C19orf60 pAb (ATL-HPA043414) Datasheet (External Link) | 
| Vendor Page | Anti C19orf60 pAb (ATL-HPA043414) at Atlas Antibodies | 
| Documents & Links for Anti C19orf60 pAb (ATL-HPA043414) | |
| Datasheet | Anti C19orf60 pAb (ATL-HPA043414) Datasheet (External Link) | 
| Vendor Page | Anti C19orf60 pAb (ATL-HPA043414) |