Anti C19orf60 pAb (ATL-HPA043414)
Atlas Antibodies
- SKU:
- ATL-HPA043414-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C19orf60
Alternative Gene Name: FLJ20850, FLJ30108, FLJ34606, FLJ37391
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058833: 69%, ENSRNOG00000017692: 29%
Entrez Gene ID: 55049
Uniprot ID: Q96EN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TVALLQLMETPELAGQEDAVRMQQLKMKVIKTMEAISEVLQDLRFDAESAE |
Gene Sequence | TVALLQLMETPELAGQEDAVRMQQLKMKVIKTMEAISEVLQDLRFDAESAE |
Gene ID - Mouse | ENSMUSG00000058833 |
Gene ID - Rat | ENSRNOG00000017692 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C19orf60 pAb (ATL-HPA043414) | |
Datasheet | Anti C19orf60 pAb (ATL-HPA043414) Datasheet (External Link) |
Vendor Page | Anti C19orf60 pAb (ATL-HPA043414) at Atlas Antibodies |
Documents & Links for Anti C19orf60 pAb (ATL-HPA043414) | |
Datasheet | Anti C19orf60 pAb (ATL-HPA043414) Datasheet (External Link) |
Vendor Page | Anti C19orf60 pAb (ATL-HPA043414) |