Anti C19orf60 pAb (ATL-HPA043414)

Atlas Antibodies

Catalog No.:
ATL-HPA043414-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 60
Gene Name: C19orf60
Alternative Gene Name: FLJ20850, FLJ30108, FLJ34606, FLJ37391
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058833: 69%, ENSRNOG00000017692: 29%
Entrez Gene ID: 55049
Uniprot ID: Q96EN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVALLQLMETPELAGQEDAVRMQQLKMKVIKTMEAISEVLQDLRFDAESAE
Gene Sequence TVALLQLMETPELAGQEDAVRMQQLKMKVIKTMEAISEVLQDLRFDAESAE
Gene ID - Mouse ENSMUSG00000058833
Gene ID - Rat ENSRNOG00000017692
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf60 pAb (ATL-HPA043414)
Datasheet Anti C19orf60 pAb (ATL-HPA043414) Datasheet (External Link)
Vendor Page Anti C19orf60 pAb (ATL-HPA043414) at Atlas Antibodies

Documents & Links for Anti C19orf60 pAb (ATL-HPA043414)
Datasheet Anti C19orf60 pAb (ATL-HPA043414) Datasheet (External Link)
Vendor Page Anti C19orf60 pAb (ATL-HPA043414)