Anti C19orf54 pAb (ATL-HPA059628)

Atlas Antibodies

Catalog No.:
ATL-HPA059628-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 54
Gene Name: C19orf54
Alternative Gene Name: FLJ41131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078786: 83%, ENSRNOG00000037715: 83%
Entrez Gene ID: 284325
Uniprot ID: Q5BKX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLVTGHPLLIPYDEDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLP
Gene Sequence HLVTGHPLLIPYDEDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLP
Gene ID - Mouse ENSMUSG00000078786
Gene ID - Rat ENSRNOG00000037715
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf54 pAb (ATL-HPA059628)
Datasheet Anti C19orf54 pAb (ATL-HPA059628) Datasheet (External Link)
Vendor Page Anti C19orf54 pAb (ATL-HPA059628) at Atlas Antibodies

Documents & Links for Anti C19orf54 pAb (ATL-HPA059628)
Datasheet Anti C19orf54 pAb (ATL-HPA059628) Datasheet (External Link)
Vendor Page Anti C19orf54 pAb (ATL-HPA059628)