Anti C19orf53 pAb (ATL-HPA059928)

Atlas Antibodies

Catalog No.: ATL-HPA059928-25

Protein Description: chromosome 19 open reading frame 53
Gene Name: C19orf53
Alternative Gene Name: HSPC023, LYDG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019362: 77%, ENSRNOG00000049931: 77%
Entrez Gene ID: 28974
Uniprot ID: Q9UNZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPRKARVVQQQ
• Gene Sequence: GQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPRKARVVQQQ
• Gene ID - Mouse: ENSMUSG00000019362
• Gene ID - Rat: ENSRNOG00000049931
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.