Anti C19orf53 pAb (ATL-HPA059928)

Atlas Antibodies

Catalog No.:
ATL-HPA059928-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 53
Gene Name: C19orf53
Alternative Gene Name: HSPC023, LYDG10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019362: 77%, ENSRNOG00000049931: 77%
Entrez Gene ID: 28974
Uniprot ID: Q9UNZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPRKARVVQQQ
Gene Sequence GQRKFQAHKPAKSKTAAAASEKNRGPRKGGRVIAPRKARVVQQQ
Gene ID - Mouse ENSMUSG00000019362
Gene ID - Rat ENSRNOG00000049931
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf53 pAb (ATL-HPA059928)
Datasheet Anti C19orf53 pAb (ATL-HPA059928) Datasheet (External Link)
Vendor Page Anti C19orf53 pAb (ATL-HPA059928) at Atlas Antibodies

Documents & Links for Anti C19orf53 pAb (ATL-HPA059928)
Datasheet Anti C19orf53 pAb (ATL-HPA059928) Datasheet (External Link)
Vendor Page Anti C19orf53 pAb (ATL-HPA059928)