Anti C19orf48 pAb (ATL-HPA042000 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042000-25

Protein Description: chromosome 19 open reading frame 48
Gene Name: C19orf48
Alternative Gene Name: MGC13170
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045411: 40%, ENSRNOG00000019132: 40%
Entrez Gene ID: 84798
Uniprot ID: Q6RUI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
• Gene Sequence: MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
• Gene ID - Mouse: ENSMUSG00000045411
• Gene ID - Rat: ENSRNOG00000019132
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.