Anti C19orf48 pAb (ATL-HPA042000 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042000-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 48
Gene Name: C19orf48
Alternative Gene Name: MGC13170
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045411: 40%, ENSRNOG00000019132: 40%
Entrez Gene ID: 84798
Uniprot ID: Q6RUI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
Gene Sequence MTVLEAVLEIQAITGSRLLSMVPGPARPPGSCWDPTQCTRTWLLSHTPRRRWISGLPR
Gene ID - Mouse ENSMUSG00000045411
Gene ID - Rat ENSRNOG00000019132
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf48 pAb (ATL-HPA042000 w/enhanced validation)
Datasheet Anti C19orf48 pAb (ATL-HPA042000 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C19orf48 pAb (ATL-HPA042000 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti C19orf48 pAb (ATL-HPA042000 w/enhanced validation)
Datasheet Anti C19orf48 pAb (ATL-HPA042000 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti C19orf48 pAb (ATL-HPA042000 w/enhanced validation)