Anti C19orf47 pAb (ATL-HPA041843)

Atlas Antibodies

Catalog No.: ATL-HPA041843-25

Protein Description: chromosome 19 open reading frame 47
Gene Name: C19orf47
Alternative Gene Name: FLJ36888
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049643: 87%, ENSRNOG00000018408: 86%
Entrez Gene ID: 126526
Uniprot ID: Q8N9M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVVGDIIAILKHAKVVHRQDMCKAATESVPCSPSPLAGEIRRGTSAASRMITNSLNHDSPPSTPPRRPDTSTSKISVT
• Gene Sequence: TVVGDIIAILKHAKVVHRQDMCKAATESVPCSPSPLAGEIRRGTSAASRMITNSLNHDSPPSTPPRRPDTSTSKISVT
• Gene ID - Mouse: ENSMUSG00000049643
• Gene ID - Rat: ENSRNOG00000018408
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.