Anti C19orf47 pAb (ATL-HPA041843)

Atlas Antibodies

Catalog No.:
ATL-HPA041843-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 47
Gene Name: C19orf47
Alternative Gene Name: FLJ36888
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049643: 87%, ENSRNOG00000018408: 86%
Entrez Gene ID: 126526
Uniprot ID: Q8N9M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TVVGDIIAILKHAKVVHRQDMCKAATESVPCSPSPLAGEIRRGTSAASRMITNSLNHDSPPSTPPRRPDTSTSKISVT
Gene Sequence TVVGDIIAILKHAKVVHRQDMCKAATESVPCSPSPLAGEIRRGTSAASRMITNSLNHDSPPSTPPRRPDTSTSKISVT
Gene ID - Mouse ENSMUSG00000049643
Gene ID - Rat ENSRNOG00000018408
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf47 pAb (ATL-HPA041843)
Datasheet Anti C19orf47 pAb (ATL-HPA041843) Datasheet (External Link)
Vendor Page Anti C19orf47 pAb (ATL-HPA041843) at Atlas Antibodies

Documents & Links for Anti C19orf47 pAb (ATL-HPA041843)
Datasheet Anti C19orf47 pAb (ATL-HPA041843) Datasheet (External Link)
Vendor Page Anti C19orf47 pAb (ATL-HPA041843)