Anti C19orf47 pAb (ATL-HPA041843)
Atlas Antibodies
- SKU:
- ATL-HPA041843-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C19orf47
Alternative Gene Name: FLJ36888
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049643: 87%, ENSRNOG00000018408: 86%
Entrez Gene ID: 126526
Uniprot ID: Q8N9M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TVVGDIIAILKHAKVVHRQDMCKAATESVPCSPSPLAGEIRRGTSAASRMITNSLNHDSPPSTPPRRPDTSTSKISVT |
Gene Sequence | TVVGDIIAILKHAKVVHRQDMCKAATESVPCSPSPLAGEIRRGTSAASRMITNSLNHDSPPSTPPRRPDTSTSKISVT |
Gene ID - Mouse | ENSMUSG00000049643 |
Gene ID - Rat | ENSRNOG00000018408 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C19orf47 pAb (ATL-HPA041843) | |
Datasheet | Anti C19orf47 pAb (ATL-HPA041843) Datasheet (External Link) |
Vendor Page | Anti C19orf47 pAb (ATL-HPA041843) at Atlas Antibodies |
Documents & Links for Anti C19orf47 pAb (ATL-HPA041843) | |
Datasheet | Anti C19orf47 pAb (ATL-HPA041843) Datasheet (External Link) |
Vendor Page | Anti C19orf47 pAb (ATL-HPA041843) |