Anti C19orf44 pAb (ATL-HPA049414)

Atlas Antibodies

Catalog No.:
ATL-HPA049414-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 44
Gene Name: C19orf44
Alternative Gene Name: FLJ21742
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052794: 41%, ENSRNOG00000023700: 42%
Entrez Gene ID: 84167
Uniprot ID: Q9H6X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SEVSEHLSASSASAIQQDSTSSMQPPSEAPMVNTVSSAYSEDFENSPSLTASEPTAHSKESLDRTLDALSESSSSVKTDLPQTAESRK
Gene Sequence SEVSEHLSASSASAIQQDSTSSMQPPSEAPMVNTVSSAYSEDFENSPSLTASEPTAHSKESLDRTLDALSESSSSVKTDLPQTAESRK
Gene ID - Mouse ENSMUSG00000052794
Gene ID - Rat ENSRNOG00000023700
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf44 pAb (ATL-HPA049414)
Datasheet Anti C19orf44 pAb (ATL-HPA049414) Datasheet (External Link)
Vendor Page Anti C19orf44 pAb (ATL-HPA049414) at Atlas Antibodies

Documents & Links for Anti C19orf44 pAb (ATL-HPA049414)
Datasheet Anti C19orf44 pAb (ATL-HPA049414) Datasheet (External Link)
Vendor Page Anti C19orf44 pAb (ATL-HPA049414)