Anti C19orf35 pAb (ATL-HPA057806)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057806-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: C19orf35
Alternative Gene Name: FLJ45778
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074305: 36%, ENSRNOG00000042519: 36%
Entrez Gene ID: 374872
Uniprot ID: Q6ZS72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AAEVPERTVAQWLAEACTQPPEEFVWAVALLLLQLSAALKFLEAWGAALVELRPENLL |
| Gene Sequence | AAEVPERTVAQWLAEACTQPPEEFVWAVALLLLQLSAALKFLEAWGAALVELRPENLL |
| Gene ID - Mouse | ENSMUSG00000074305 |
| Gene ID - Rat | ENSRNOG00000042519 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C19orf35 pAb (ATL-HPA057806) | |
| Datasheet | Anti C19orf35 pAb (ATL-HPA057806) Datasheet (External Link) |
| Vendor Page | Anti C19orf35 pAb (ATL-HPA057806) at Atlas Antibodies |
| Documents & Links for Anti C19orf35 pAb (ATL-HPA057806) | |
| Datasheet | Anti C19orf35 pAb (ATL-HPA057806) Datasheet (External Link) |
| Vendor Page | Anti C19orf35 pAb (ATL-HPA057806) |