Anti C19orf33 pAb (ATL-HPA059696)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059696-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C19orf33
Alternative Gene Name: H2RSP, IMUP, IMUP-1, IMUP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030587: 58%, ENSRNOG00000056651: 56%
Entrez Gene ID: 64073
Uniprot ID: Q9GZP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSS |
Gene Sequence | MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSS |
Gene ID - Mouse | ENSMUSG00000030587 |
Gene ID - Rat | ENSRNOG00000056651 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C19orf33 pAb (ATL-HPA059696) | |
Datasheet | Anti C19orf33 pAb (ATL-HPA059696) Datasheet (External Link) |
Vendor Page | Anti C19orf33 pAb (ATL-HPA059696) at Atlas Antibodies |
Documents & Links for Anti C19orf33 pAb (ATL-HPA059696) | |
Datasheet | Anti C19orf33 pAb (ATL-HPA059696) Datasheet (External Link) |
Vendor Page | Anti C19orf33 pAb (ATL-HPA059696) |