Anti C19orf33 pAb (ATL-HPA059696)

Atlas Antibodies

Catalog No.:
ATL-HPA059696-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 33
Gene Name: C19orf33
Alternative Gene Name: H2RSP, IMUP, IMUP-1, IMUP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030587: 58%, ENSRNOG00000056651: 56%
Entrez Gene ID: 64073
Uniprot ID: Q9GZP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSS
Gene Sequence MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSS
Gene ID - Mouse ENSMUSG00000030587
Gene ID - Rat ENSRNOG00000056651
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf33 pAb (ATL-HPA059696)
Datasheet Anti C19orf33 pAb (ATL-HPA059696) Datasheet (External Link)
Vendor Page Anti C19orf33 pAb (ATL-HPA059696) at Atlas Antibodies

Documents & Links for Anti C19orf33 pAb (ATL-HPA059696)
Datasheet Anti C19orf33 pAb (ATL-HPA059696) Datasheet (External Link)
Vendor Page Anti C19orf33 pAb (ATL-HPA059696)