Anti C19orf33 pAb (ATL-HPA059696)

Atlas Antibodies

Catalog No.: ATL-HPA059696-25

Protein Description: chromosome 19 open reading frame 33
Gene Name: C19orf33
Alternative Gene Name: H2RSP, IMUP, IMUP-1, IMUP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030587: 58%, ENSRNOG00000056651: 56%
Entrez Gene ID: 64073
Uniprot ID: Q9GZP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSS
• Gene Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKQGHHSS
• Gene ID - Mouse: ENSMUSG00000030587
• Gene ID - Rat: ENSRNOG00000056651
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.