Anti C19orf25 pAb (ATL-HPA067491)
Atlas Antibodies
- SKU:
- ATL-HPA067491-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C19orf25
Alternative Gene Name: FLJ36666
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020133: 93%, ENSRNOG00000016399: 93%
Entrez Gene ID: 148223
Uniprot ID: Q9UFG5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MGSKAKKRVLLPTRPAPPTVEQILEDVRGA |
Gene Sequence | MGSKAKKRVLLPTRPAPPTVEQILEDVRGA |
Gene ID - Mouse | ENSMUSG00000020133 |
Gene ID - Rat | ENSRNOG00000016399 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C19orf25 pAb (ATL-HPA067491) | |
Datasheet | Anti C19orf25 pAb (ATL-HPA067491) Datasheet (External Link) |
Vendor Page | Anti C19orf25 pAb (ATL-HPA067491) at Atlas Antibodies |
Documents & Links for Anti C19orf25 pAb (ATL-HPA067491) | |
Datasheet | Anti C19orf25 pAb (ATL-HPA067491) Datasheet (External Link) |
Vendor Page | Anti C19orf25 pAb (ATL-HPA067491) |