Anti C19orf24 pAb (ATL-HPA043279)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043279-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: C19orf24
Alternative Gene Name: FLJ20640
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035595: 80%, ENSRNOG00000016193: 83%
Entrez Gene ID: 55009
Uniprot ID: Q9BVV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNL |
| Gene Sequence | AFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNL |
| Gene ID - Mouse | ENSMUSG00000035595 |
| Gene ID - Rat | ENSRNOG00000016193 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C19orf24 pAb (ATL-HPA043279) | |
| Datasheet | Anti C19orf24 pAb (ATL-HPA043279) Datasheet (External Link) |
| Vendor Page | Anti C19orf24 pAb (ATL-HPA043279) at Atlas Antibodies |
| Documents & Links for Anti C19orf24 pAb (ATL-HPA043279) | |
| Datasheet | Anti C19orf24 pAb (ATL-HPA043279) Datasheet (External Link) |
| Vendor Page | Anti C19orf24 pAb (ATL-HPA043279) |