Anti C19orf24 pAb (ATL-HPA043279)

Atlas Antibodies

Catalog No.:
ATL-HPA043279-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 19 open reading frame 24
Gene Name: C19orf24
Alternative Gene Name: FLJ20640
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035595: 80%, ENSRNOG00000016193: 83%
Entrez Gene ID: 55009
Uniprot ID: Q9BVV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNL
Gene Sequence AFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNL
Gene ID - Mouse ENSMUSG00000035595
Gene ID - Rat ENSRNOG00000016193
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C19orf24 pAb (ATL-HPA043279)
Datasheet Anti C19orf24 pAb (ATL-HPA043279) Datasheet (External Link)
Vendor Page Anti C19orf24 pAb (ATL-HPA043279) at Atlas Antibodies

Documents & Links for Anti C19orf24 pAb (ATL-HPA043279)
Datasheet Anti C19orf24 pAb (ATL-HPA043279) Datasheet (External Link)
Vendor Page Anti C19orf24 pAb (ATL-HPA043279)