Anti C18orf63 pAb (ATL-HPA042233)

Atlas Antibodies

Catalog No.:
ATL-HPA042233-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 18 open reading frame 63
Gene Name: C18orf63
Alternative Gene Name: DKFZP781G0119
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026103: 20%, ENSRNOG00000038241: 81%
Entrez Gene ID: 644041
Uniprot ID: Q68DL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERHSILSNWCYVLPSMKMGQIINIFHAIPAACPFHSYGDFQRHWDALYGYKLPGDCGKIKIYCNIYFKMLGERTFTYPLSCIRSQPMQF
Gene Sequence ERHSILSNWCYVLPSMKMGQIINIFHAIPAACPFHSYGDFQRHWDALYGYKLPGDCGKIKIYCNIYFKMLGERTFTYPLSCIRSQPMQF
Gene ID - Mouse ENSMUSG00000026103
Gene ID - Rat ENSRNOG00000038241
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C18orf63 pAb (ATL-HPA042233)
Datasheet Anti C18orf63 pAb (ATL-HPA042233) Datasheet (External Link)
Vendor Page Anti C18orf63 pAb (ATL-HPA042233) at Atlas Antibodies

Documents & Links for Anti C18orf63 pAb (ATL-HPA042233)
Datasheet Anti C18orf63 pAb (ATL-HPA042233) Datasheet (External Link)
Vendor Page Anti C18orf63 pAb (ATL-HPA042233)