Anti C18orf32 pAb (ATL-HPA040921)

Atlas Antibodies

Catalog No.: ATL-HPA040921-25

Protein Description: chromosome 18 open reading frame 32
Gene Name: C18orf32
Alternative Gene Name: FLJ23458
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036299: 70%, ENSRNOG00000018676: 64%
Entrez Gene ID: 497661
Uniprot ID: Q8TCD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDK
• Gene Sequence: PFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDK
• Gene ID - Mouse: ENSMUSG00000036299
• Gene ID - Rat: ENSRNOG00000018676
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.