Anti C18orf25 pAb (ATL-HPA065021)

Atlas Antibodies

SKU: ATL-HPA065021-25

• 

Protein Description: chromosome 18 open reading frame 25
Gene Name: C18orf25
Alternative Gene Name: ARKL1, MGC12909, RNF111L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047466: 85%, ENSRNOG00000017215: 87%
Entrez Gene ID: 147339
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPR
• Gene Sequence: QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPR
• Gene ID - Mouse: ENSMUSG00000047466
• Gene ID - Rat: ENSRNOG00000017215
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.