Anti C18orf25 pAb (ATL-HPA065021)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065021-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: C18orf25
Alternative Gene Name: ARKL1, MGC12909, RNF111L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047466: 85%, ENSRNOG00000017215: 87%
Entrez Gene ID: 147339
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPR |
Gene Sequence | QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPR |
Gene ID - Mouse | ENSMUSG00000047466 |
Gene ID - Rat | ENSRNOG00000017215 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti C18orf25 pAb (ATL-HPA065021) | |
Datasheet | Anti C18orf25 pAb (ATL-HPA065021) Datasheet (External Link) |
Vendor Page | Anti C18orf25 pAb (ATL-HPA065021) at Atlas Antibodies |
Documents & Links for Anti C18orf25 pAb (ATL-HPA065021) | |
Datasheet | Anti C18orf25 pAb (ATL-HPA065021) Datasheet (External Link) |
Vendor Page | Anti C18orf25 pAb (ATL-HPA065021) |