Anti C18orf25 pAb (ATL-HPA051314)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051314-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C18orf25
Alternative Gene Name: ARKL1, MGC12909, RNF111L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047466: 97%, ENSRNOG00000061540: 95%
Entrez Gene ID: 147339
Uniprot ID: Q96B23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSAEENEPSQAETAVEGDPSGVSGATVGRKSRRSRSESETSTMA |
| Gene Sequence | ESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSAEENEPSQAETAVEGDPSGVSGATVGRKSRRSRSESETSTMA |
| Gene ID - Mouse | ENSMUSG00000047466 |
| Gene ID - Rat | ENSRNOG00000061540 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C18orf25 pAb (ATL-HPA051314) | |
| Datasheet | Anti C18orf25 pAb (ATL-HPA051314) Datasheet (External Link) |
| Vendor Page | Anti C18orf25 pAb (ATL-HPA051314) at Atlas Antibodies |
| Documents & Links for Anti C18orf25 pAb (ATL-HPA051314) | |
| Datasheet | Anti C18orf25 pAb (ATL-HPA051314) Datasheet (External Link) |
| Vendor Page | Anti C18orf25 pAb (ATL-HPA051314) |