Anti C18orf25 pAb (ATL-HPA051314)

Atlas Antibodies

Catalog No.:
ATL-HPA051314-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: chromosome 18 open reading frame 25
Gene Name: C18orf25
Alternative Gene Name: ARKL1, MGC12909, RNF111L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047466: 97%, ENSRNOG00000061540: 95%
Entrez Gene ID: 147339
Uniprot ID: Q96B23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSAEENEPSQAETAVEGDPSGVSGATVGRKSRRSRSESETSTMA
Gene Sequence ESQLASTESDKPTTGRVYESDSSNHCMLSPSSSGHLADSDTLSSAEENEPSQAETAVEGDPSGVSGATVGRKSRRSRSESETSTMA
Gene ID - Mouse ENSMUSG00000047466
Gene ID - Rat ENSRNOG00000061540
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C18orf25 pAb (ATL-HPA051314)
Datasheet Anti C18orf25 pAb (ATL-HPA051314) Datasheet (External Link)
Vendor Page Anti C18orf25 pAb (ATL-HPA051314) at Atlas Antibodies

Documents & Links for Anti C18orf25 pAb (ATL-HPA051314)
Datasheet Anti C18orf25 pAb (ATL-HPA051314) Datasheet (External Link)
Vendor Page Anti C18orf25 pAb (ATL-HPA051314)