Anti C18orf21 pAb (ATL-HPA067322)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067322-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: C18orf21
Alternative Gene Name: HsT3108, PNAS-124, PNAS-131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024273: 59%, ENSRNOG00000015546: 56%
Entrez Gene ID: 83608
Uniprot ID: Q32NC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKG |
| Gene Sequence | TCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKG |
| Gene ID - Mouse | ENSMUSG00000024273 |
| Gene ID - Rat | ENSRNOG00000015546 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti C18orf21 pAb (ATL-HPA067322) | |
| Datasheet | Anti C18orf21 pAb (ATL-HPA067322) Datasheet (External Link) |
| Vendor Page | Anti C18orf21 pAb (ATL-HPA067322) at Atlas Antibodies |
| Documents & Links for Anti C18orf21 pAb (ATL-HPA067322) | |
| Datasheet | Anti C18orf21 pAb (ATL-HPA067322) Datasheet (External Link) |
| Vendor Page | Anti C18orf21 pAb (ATL-HPA067322) |