Anti C18orf21 pAb (ATL-HPA067322)

Atlas Antibodies

SKU: ATL-HPA067322-25

• 

Protein Description: chromosome 18 open reading frame 21
Gene Name: C18orf21
Alternative Gene Name: HsT3108, PNAS-124, PNAS-131
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024273: 59%, ENSRNOG00000015546: 56%
Entrez Gene ID: 83608
Uniprot ID: Q32NC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKG
• Gene Sequence: TCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKG
• Gene ID - Mouse: ENSMUSG00000024273
• Gene ID - Rat: ENSRNOG00000015546
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.