Anti C17orf98 pAb (ATL-HPA051696)

Atlas Antibodies

Catalog No.:
ATL-HPA051696-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: chromosome 17 open reading frame 98
Gene Name: C17orf98
Alternative Gene Name: LOC388381
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018543: 71%, ENSRNOG00000036888: 72%
Entrez Gene ID: 388381
Uniprot ID: A8MV24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AYLSECRLRLEKGFILDGVAVSTAARAYGRSRPKLWSAIPPYNAQQDYHARSYFQSHVVPPLLRKTDQDHGGTGRDGWI
Gene Sequence AYLSECRLRLEKGFILDGVAVSTAARAYGRSRPKLWSAIPPYNAQQDYHARSYFQSHVVPPLLRKTDQDHGGTGRDGWI
Gene ID - Mouse ENSMUSG00000018543
Gene ID - Rat ENSRNOG00000036888
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti C17orf98 pAb (ATL-HPA051696)
Datasheet Anti C17orf98 pAb (ATL-HPA051696) Datasheet (External Link)
Vendor Page Anti C17orf98 pAb (ATL-HPA051696) at Atlas Antibodies

Documents & Links for Anti C17orf98 pAb (ATL-HPA051696)
Datasheet Anti C17orf98 pAb (ATL-HPA051696) Datasheet (External Link)
Vendor Page Anti C17orf98 pAb (ATL-HPA051696)